PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe7G002200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 240aa    MW: 27540.7 Da    PI: 5.0941
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe7G002200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.31.5e-193690256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       +++++f++eq++ +e++Fe+++++  +++ +LAk+l+L+ rqV +WFqNrRa++k
  Aqcoe7G002200.1.p 36 KNKRRFSNEQIRSMETMFESESKLEPKTKLQLAKQLDLQPRQVAIWFQNRRARWK 90
                       67889*************************************************9 PP

2HD-ZIP_I/II119.61.6e-3837128293
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                        +krr+s+eq++++E++Fe+e+kLep+ K +la++L+lqprqva+WFqnrRAR+k+kqlE+dy+ Lk+ yd+l+++ e+++k+++ L ++l++
  Aqcoe7G002200.1.p  37 NKRRFSNEQIRSMETMFESESKLEPKTKLQLAKQLDLQPRQVAIWFQNRRARWKSKQLERDYNLLKADYDTLASQFESIKKDKQILLQQLQK 128
                        79*************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.21E-191894IPR009057Homeodomain-like
PROSITE profilePS5007117.8963292IPR001356Homeobox domain
SMARTSM003893.6E-163496IPR001356Homeobox domain
PfamPF000466.0E-173690IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-193799IPR009057Homeodomain-like
CDDcd000867.21E-154193No hitNo description
PROSITE patternPS0002706790IPR017970Homeobox, conserved site
PfamPF021834.4E-1492132IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MLEKGDYFPT AASTKVEPST SSDSTLTTTR KNKKNKNKRR FSNEQIRSME TMFESESKLE  60
PKTKLQLAKQ LDLQPRQVAI WFQNRRARWK SKQLERDYNL LKADYDTLAS QFESIKKDKQ  120
ILLQQLQKLN DLRQKEKEES RSCPLSLDGN STDCESDKYE PEHKSGVSFE GSNLRLALGS  180
DDENNHTMYL EEGEEADPMS IMDPANPILL SPGNWSTFGS DNGLLDQSCS TSQWWEIWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18492RRARWKSKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00320DAPTransfer from AT2G46680Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251668.17e-70PREDICTED: homeobox-leucine zipper protein ATHB-12-like isoform X1
TrEMBLB9I9241e-63B9I924_POPTR; Homeobox leucine zipper family protein
STRINGPOPTR_0014s09860.13e-63(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.21e-40homeobox 7